ELISA Recombinant Rat Mas-related G-protein coupled receptor member A(Mrgpra)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q7TN49 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDKTIPGSFNSRTLIPNLLIIISGLVGLIGNAMVFWLLGFRLARNAFSVYILNLALADFL FLLCHIIDSTLLLLKFSYPNIIFLPCFNTVMMVPYIAGLSmLSAISTERCLSVVCPIWYR CRRPKHTSTVMCSAIWVLSLLICILNRYFCGFLDTKYEKDNRCLASNFFTAACLIFLFVV LCLSSLALLVRLFCGAGRMKLTRLYATImLTVLVFLLCGLPFGIHWFLLIWIKIDYGKFA YGLYLAALVLTAVNSCANPIIYFFVGSFRHQKHQTLKMVLQRALQDTPETAENTVEMSSS KVEP Protein Names:Recommended name: Mas-related G-protein coupled receptor member A Gene Names:Name:Mrgpra Synonyms:Mrga Expression Region:1-304 Sequence Info:fµLl length protein