ELISA Recombinant Xenopus laevis Reticulon-1-A(rtn1-a)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Xenopus laevis (African clawed frog) Uniprot NO.:Q6IFY7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MQASADSTRMECLWSNWKCQAIDLLYWRDIKQTGIVFGSVLLmLFSLIQFSVVSVMAYLA LAALSATISFRIYKSVLQAVQKTDEGHPFKSYLDMEISLSQEQIQKYTDCLQVYTNSIAK ELRRLFLVQDLVDSLKFAVLMWLLTYVGALFNGLTLLIMAVVSMFSLPVVYDKYQAQIDQ YLGLVRTNMNTIMTKIQAKIPGTKQKE Protein Names:Recommended name: ReticµLon-1-A Alternative name(s): RTN1.1 Short name= xRTN1 XRTN1-C.1 Gene Names:Name:rtn1-a Expression Region:1-207 Sequence Info:fµLl length protein