ELISA Recombinant Xenopus laevis Endoplasmic reticulum-Golgi intermediate compartment protein 1(ergic1)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Xenopus laevis (African clawed frog) Uniprot NO.:Q6NS19 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MPFDFRRFDIYRKVPKDLTQPTYTGAIISICCCLFITFLFLSELTGFIANEIVNELYVDD PDKDSGGKIDVTLNVTLPNLPCEVVGLDIQDEMGRHEVGHIDNSMKIPINNAYGCRFEGL FSINKVPGNFHVSTHSAIAQPANPDMRHIIHKLSFGNTLQVDNIHGAFNALGGADKLASK ALESHDYVLKIVPTVYEDLNGKQQFSYQYTVANKAYVAYSHTGRVVPAIWFRYDLSPITV KYTERRQPMYRFITTVCAIIGGTFTVAGILDSFIFTASEAWKKIQLGKMQ Protein Names:Recommended name: Endoplasmic reticµLum-Golgi intermediate compartment protein 1 Alternative name(s): ER-Golgi intermediate compartment 32 kDa protein Short name= ERGIC-32 Gene Names:Name:ergic1 Synonyms:ergic32 Expression Region:1-290 Sequence Info:fµLl length protein