ELISA Recombinant Xenopus laevis Inositol monophosphatase 3(impad1)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Xenopus laevis (African clawed frog) Uniprot NO.:Q6NTW5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAPMGIRLSPLGIGVFCLLALGVLYHVYSGFLTGRFAAFLLGDRAGDTVDLRELLAVSVR AAELGGVEVKKVRESNSLNEKAKGKTREGEDEKMTSGDVLSNKKMYHLIKNAFPAVLVNT EEQVDPDEEDAVSWDHDIPDEIKDKIKTSKPVSSESITIWIDPLDATHEYAENLVKYVTT MVCVAVNGKPVIGVIHKPFTGYTAWAMVDEGANIKKRSSYNEKTPTFIVSRSHSGEVKEV TRQTFGNKTEIISAGGAGYKVLSLLDVTADEQEKADVYIHVTYIKKWDICAGNAILNALG GHMTTLKGEEISYTGSEQNEGGLLASIGMDHSALVGKLAEKISVNAKKPAK Protein Names:Recommended name: Inositol monophosphatase 3 Short name= IMP 3 Short name= IMPase 3 EC= 3.1.3.25 Alternative name(s): Inositol monophosphatase domain-containing protein 1 Inositol-1(or 4)-monophosphatase 3 Myo-inositol Gene Names:Name:impad1 Synonyms:impa3 Expression Region:1-351 Sequence Info:fµLl length protein