ELISA Recombinant Rat Lipid phosphate phosphatase-related protein type 1(Lppr1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q6WAY2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAVENNTQRSYSIIPCFIFVELVIMAGTVLLAYYFECTDTFQVHIQGFFCQDGDLMKPYP GTEEESFISPLVLYCVLAATPTAIIFIGEISMYFIKSTRESLIAEEKMILTGDCCYLSPL LRRIVRFIGVFAFGLFATDIFVNAGQVVTGHLTPYFLTVCQPNYTSTDCRAHHQFINNGN ICTGDLEVIEKARRSFPSKHAALSIYSALYATMYITSTIKTKSSRLAKPVLCLGDLCTAF LTGLNRVSEYRNHCSDVIAGFILGTAVALFLGMCVVHNFKGTQGSASKPKPEDPRGVPLM AFPRIESPLETLSAQNHSASMTEVT Protein Names:Recommended name: Lipid phosphate phosphatase-related protein type 1 Alternative name(s): Plasticity-related gene 3 protein Short name= PRG-3 Gene Names:Name:Lppr1 Synonyms:Prg3 Expression Region:1-325 Sequence Info:fµLl length protein