Skip to Content

ELISA Recombinant Rat Voltage-dependent calcium channel gamma-2 subunit(Cacng2)

https://www.anagnostics.com/web/image/product.template/153286/image_1920?unique=e16ca1f
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q71RJ2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGLFDRGVQmLLTTVGAFAAFSLMTIAVGTDYWLYSRGVCKTKSVSENETSKKNEEVMTH SGLWRTCCLEGNFKGLCKQIDHFPEDADYEADTAEYFLRAVRASSIFPILSVILLFMGGL CIAASEFYKTRHNIILSAGIFFVSAGLSNIIGIIVYISANAGDPSKSDSKKNSYSYGWSF YFGALSFIIAEMVGVLAVHMFIDRHKQLRATARATDYLQASAITRIPSYRYRYQRRSRSS SRSTEPSHSRDASPVGVKGFNTLPSTEISMYTLSRDPLKAATTPTATYNSDRDNSFLQVH NCIQKDSKDSLHANTANRRTTPV Protein Names:Recommended name: Voltage-dependent calcium channel gamma-2 subunit Alternative name(s): Neuronal voltage-gated calcium channel gamma-2 subunit Transmembrane AMPAR regµLatory protein gamma-2 Short name= TARP gamma-2 Gene Names:Name:Cacng2 Expression Region:1-323 Sequence Info:fµLl length protein

1,676.00 € 1676.0 EUR 1,676.00 €

1,676.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.