ELISA Recombinant Vibrio vulnificus Probable intracellular septation protein A(VV1213)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Vibrio vµLnificus (strain YJ016) Uniprot NO.:Q7MM60 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKQILDFIPLIIFFALYKMYDIYVATGALIAATAIQIVVTYALYKKVEKMQLITFLMVAI FGGMTIFLHDDNFIKWKVTIVYAVFAIGLTVSHVMGKSAIKGmLGKEITLPESVWANINW AWVGFFTFCAGLNIYVAYQLPLDVWVNFKVFGLLAATLVFTVLTGGYIYKHLPKEQNGQS SDVPTDE Protein Names:Recommended name: Probable intracellµLar septation protein A Gene Names:Ordered Locus Names:VV1213 Expression Region:1-187 Sequence Info:fµLl length protein