ELISA Recombinant Xenopus laevis Lipid phosphate phosphatase-related protein type 5(lppr5)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Xenopus laevis (African clawed frog) Uniprot NO.:Q6GM05 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSFQFSLTImLYFQMVIMAGTVmLAYYFEYTDTFTVNVQGFFCYDSSYTKPYPGPDESSD IPPVLLLSLVTGVPVLVIIVGETVVFCLQVATRDFENQEKTLLTGDCCYINPLVRRTVRF LGIYTFGLFATDIFVNAGQVVTGNLAPHFLTVCKPNYTALGCRQFTQFITDANACTGIPD LVIKARRTFPSKDAALSVYAALYLAMYITSTIKAKGTRLAKPVLCLGLMCLAFLTGINRV AEYRNHWSDVIAGFLIGISIAVFLVVCVVNNFKGRRTEHEHWPTENLAQMPIISIPRVEN PLEKNHLTAFAEVT Protein Names:Recommended name: Lipid phosphate phosphatase-related protein type 5 EC= 3.1.3.- Gene Names:Name:lppr5 Expression Region:1-314 Sequence Info:fµLl length protein