ELISA Recombinant Sheep Lens fiber major intrinsic protein(MIP)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Ovis aries (Sheep) Uniprot NO.:Q6J8I9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MWELRSASFWRAIFAEFFATLFYVFFGLGASLRWAPGPLHVLQVALAFGLALATLVQAVG HISGAHVNPAVTFAFLVGSQMSLLRAICYVVAQLLGAVAGAAVLYSVTPPAVRGNLALNT LHPGVSVGQATIVEIFLTLQFVLCIFATYDERRNGRLGSVALAVGFSLTLGHLFGMYYTG AGMNPARSFAPAILTRNFTNHWVYWVGPVIGAGLGSLLYDFLLFPRLKSVSERLSILKGT RPSESNGQPEVTGEPVELKTQAL Protein Names:Recommended name: Lens fiber major intrinsic protein Alternative name(s): Aquaporin-0 Gene Names:Name:MIP Synonyms:AQP0 Expression Region:1-263 Sequence Info:fµLl length protein