ELISA Recombinant Psittacid herpesvirus 1 Glycoprotein N(UL49.5)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Psittacid herpesvirus 1 (isolate Amazon parrot/-/97-0001/1997) (PsHV-1) (Pacheco's disease virus) Uniprot NO.:Q6UDL9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:AQLDAGILNPWGSAGHNDAVMPGMFANSESDERFYSPHCSSRGLPLVNESMASVIFFLSL AMVCVAIVAILYNCCFNSFKNSVINSRW Protein Names:Recommended name: Glycoprotein N Short name= gN Alternative name(s): Protein µL49.5 Protein µL49A Gene Names:Name:µL49.5 Expression Region:28-115 Sequence Info:fµLl length protein