ELISA Recombinant Translocator protein(TSPO)

>Several Other Quantitys Are Also Available. Please Inquire. DefaµLt Quantity: 10µg Updated Date: Stock Protein updated on 20171228 Research areas: Cancer Target / Protein: TSPO Biologically active: Not Tested Expression system: in vitro E.coli expression system Species of origin: Sus scrofa (Pig) Delivery time: 3-7 business days Uniprot ID: Q6UN27 AA Sequence: MAPPWLPAVGFTLVPSLGGFLSSRNVLGKGLHWYAGLQKPSWHPPHWTLAPIWGTLYSAMGYGSYMIWKELGGFSEEAVVPLGLYAGQLALNWAWPPLFFGARQMGWALVDLVLTGGVAAATAVAWYQVSPLAARLLYPYLAWLAFAATLNYCVWRDNQGRRGGRRPSE Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged Expression Region: 1-169aa Protein length: FµLl Length MW: 38.6 kDa Alternative Name(s): Peripheral-type benzodiazepine receptor Relevance: Promotes the transport of cholesterol across mitochondrial membranes and may play a role in lipid metabolism, but its precise physiological role is controversial. It is apparently not required for steroid hormone biosynthesis. Can bind protoporphyrin IX and may play a role in the transport of porphyrins and heme. Was initially identified as peripheral-type benzodiazepine receptor; can also bind isoquinoline carboxamides Reference: "Cloning, sequencing, and chromosomal localization of pig peripheral benzodiazepine receptor: three different forms produced by alternative splicing." Zhang K., Demeure O., Belliard A., Goujon J.M., Favreau F., Desurmont T., Mauco G., Barriere M., Carretier M., Milan D., PapadopoµLos V., Hauet T. Mamm. Genome 17:1050-1062(2006) Purity: Greater than 85% as determined by SDS-PAGE. Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.