ELISA Recombinant Xenopus laevis Protein YIPF5(yipf5)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Xenopus laevis (African clawed frog) Uniprot NO.:Q7SXS2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSNFDNFNTDFYQTSYSIDDQSQGYNYNAGGAQYSKQYPYDPYSQQGGFILQEMNQQQQP YTGQIYQPTQTYTPTATESVYGSTFDDEPPLLEELGINFDHIWQKTLTVLHPLKVADGSI MNETDLAGPMVFCLAFGATLLLAGKIQFGYVYGISAMGCLGMYCLLNLMSMTGVSFGCVS SVLGYCLLPMIILSTFAVIFSLQGILGIVLAALIIGWCSFSASKIFISALAMDGQQLLVA YPCALLYGVFALISVF Protein Names:Recommended name: Protein YIPF5 Alternative name(s): YIP1 family member 5 Gene Names:Name:yipf5 Expression Region:1-256 Sequence Info:fµLl length protein