ELISA Recombinant Synechococcus sp. NAD(P)H-quinone oxidoreductase subunit L(ndhL)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Synechococcus sp. (strain WH8102)
Uniprot NO.:Q7U620
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDLQSLASSIPQDTLLVILAYALLGGLYLLVVPLALFFWMNSRWTRMGKIERLLVYGLVF LFFPGMVVFAPFLNFRLSGQGDN
Protein Names:Recommended name: NAD(P)H-quinone oxidoreductase subunit L EC= 1.6.5.- Alternative name(s): NAD(P)H dehydrogenase I subunit L NDH-1 subunit L NDH-L
Gene Names:Name:ndhL Ordered Locus Names:SYNW1521
Expression Region:1-83
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.