ELISA Recombinant Synechococcus sp. NAD(P)H-quinone oxidoreductase subunit 3(ndhC)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Synechococcus sp. (strain WH8102)
Uniprot NO.:Q7U9P6
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MFALPGYDAFLGFLLIAAAVPALALITNKFLAPKSRAGERQLTYESGMEPIGGAWIQFNI RYYMFALVFVIFDVETVFLYPWAVAFHRLGVLAFIEALIFITILLVALAYAWRKGALEWS
Protein Names:Recommended name: NAD(P)H-quinone oxidoreductase subunit 3 EC= 1.6.5.- Alternative name(s): NAD(P)H dehydrogenase subunit 3 NADH-plastoquinone oxidoreductase subunit 3 NDH-1 subunit 3 Short name= NDH-C
Gene Names:Name:ndhC Ordered Locus Names:SYNW0207
Expression Region:1-120
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.