ELISA Recombinant Prochlorococcus marinus subsp. pastoris Photosystem I reaction center subunit XI(psaL)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) Uniprot NO.:Q7UZX6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSDFQKSFSESTSSIKFDEKYIDNSVQPNDIGIANQWAVKPVSDPCVGNLATPVNSGYFT KAFINNLPFYREGISPNFRGLETGAAFGYLLYGPFSMTGPLRNSDFALTAGLLATIGAVH ILTGLLVLYNAPGKAPNVQPPDATVYNPPADLFTRTGWADFTSGFWLGGCGGAVFAWLLV GTLHLDTIMPIVKNIWTTG Protein Names:Recommended name: Photosystem I reaction center subunit XI Alternative name(s): PSI subunit V PSI-L Gene Names:Name:psaL Ordered Locus Names:PMM1519 Expression Region:1-199 Sequence Info:fµLl length protein