ELISA Recombinant Tropheryma whipplei Protease HtpX homolog(htpX)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Tropheryma whipplei (strain Twist) (Whipple's bacillus) Uniprot NO.:Q83H47 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MMYSFIARNKINTFLILFVFILACGGFGLLAGRFLGMSFFLFILLLAAGYACVQYFFSGR LAVLMSGARKISRNDNPRLWNTVENLSITTGLPMPEVYIVDDPAPNAFATGRDPKHAKVA ATSGLLEILDDSELEGVMAHEMGHVKNYDIRVSTIVFGLVSAVGLISDMVLRALIWGDNR REGNSAFSFVIVLFFSLLAPIAAmLVQLAVSREREYLADATGALTTRYPAALASALAKLE GNARPLQRQSSSMAHLWISNPMPRGFFRKLFSTHPPTEERIRRLKEMGNQF Protein Names:Recommended name: Protease HtpX homolog EC= 3.4.24.- Gene Names:Name:htpX Synonyms:twt013 Ordered Locus Names:TWT_013 Expression Region:1-291 Sequence Info:fµLl length protein