ELISA Recombinant Pongo pygmaeus Vomeronasal type-1 receptor 4(VN1R4)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Pongo pygmaeus (Bornean orangutan) Uniprot NO.:Q7YRP2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MASRYVAVGMmLSQTVVGVLGSFSLLLHYLSLHYIGCRLRSADLIVKHLIAASFLTLLCK GVPQTMAAFRVRYFLNAIGCKLVFYLHRVGRGVSTGTTCLLSVFQVITVSSRKSRWAKLK EKAPKHVGFSVLLCWILCmLVNIIFPIYVTGKRNHTNITVNKDLGDCCGRGNNKIAQTLR AmLLSFPDVLCLGFmLWASSSMVCILHRHKQRVQHIHRSNLSPRASPENRATQSILIPVS TFVSSYTLSCLLQVCMALLDNPNSLLVNTSALMSACFPTLSPFVLMSCDPSVYRLCFAWK R Protein Names:Recommended name: Vomeronasal type-1 receptor 4 Alternative name(s): V1r-like receptor 4 Gene Names:Name:VN1R4 Synonyms:V1RL4 Expression Region:1-301 Sequence Info:fµLl length protein