Skip to Content

ELISA Recombinant Rat Reticulon-4 receptor-like 1(Rtn4rl1)

https://www.anagnostics.com/web/image/product.template/152919/image_1920?unique=e16ca1f
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q80WD0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:CPRDCVCYPSPMTVSCQAHNFAAIPEGIPEDSERIFLQNNHITFLQQGHFSPAMVTLWIY SNNITFIAPNTFEGFVHLEELDLGDNRQLRTLAPETFQGLVKLHALYLYKCGLSSLPAGI FGGLHSLQYLYLQDNHIEYLQDDIFVDLVNLSHLFLHGNKLWSLGQGIFRGLVNLDRLLL HENQLQWVHHKAFHDLHRLTTLFLFNNSLTELQGDCLAPLVALEFLRLNGNAWDCGCRAR SLWEWLRRFRGSSSVVPCATPELRQGQDLKSLRVEDFRNCTGPASPHQIKSHTLSTSDRA ARKEHHPSHGASRDKGHPHGHLPGSRSGSKKPGKNCTSHRNRNQISKGSAGKELPELQDY APDYQHKFSFDIMPTARPKRKGKCARRTPIRAPSGVQQAS Protein Names:Recommended name: ReticµLon-4 receptor-like 1 Alternative name(s): Nogo receptor-like 2 Nogo-66 receptor homolog 2 Nogo-66 receptor-related protein 3 Short name= NgR3 Gene Names:Name:Rtn4rl1 Synonyms:Ngrh2 Expression Region:25-424 Sequence Info:fµLl length protein

1,757.00 € 1757.0 EUR 1,757.00 €

1,757.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.