ELISA Recombinant Rat Hydroxycarboxylic acid receptor 2(Hcar2)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q80Z39 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSKQNHFLVINGKNCCVFRDENIAKVLPPVLGLEFVFGLLGNGLALWIFCFHLKSWKSSR IFLFNLAVADFLLIICLPFLTDNYVQNWDWRFGSIPCRVmLFmLAMNRQGSIIFLTVVAV DRYFRVVHPHHFLNKISNRTAAIISCFLWGITIGLTVHLLYTDMMTRNGDANLCSSFSIC YTFRWHDAMFLLEFFLPLGIILFCSGRIIWSLRQRQMDRHVKIKRAINFIMVVAIVFVIC FLPSVAVRIRIFWLLYKHNVRNCDIYSSVDLAFFTTLSFTYMNSmLDPVVYYFSSPSFPN FFSTCINRCLRRKTLGEPDNNRSTSVELTGDPSTIRSIPGALMTDPSEPGSPPYLASTSR Protein Names:Recommended name: Hydroxycarboxylic acid receptor 2 Alternative name(s): G-protein coupled receptor 109 G-protein coupled receptor 109A G-protein coupled receptor HM74 Niacin receptor 1 Nicotinic acid receptor Protein PUMA-G Gene Names:Name:Hcar2 Synonyms:Gpr109, Gpr109a, Gpr109b, Niacr1, Pumag Expression Region:1-360 Sequence Info:fµLl length protein