Skip to Content

ELISA Recombinant Tropheryma whipplei Lipoprotein signal peptidase(lspA)

https://www.anagnostics.com/web/image/product.template/160266/image_1920?unique=871b00d
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Tropheryma whipplei (strain TW08/27) (Whipple's bacillus) Uniprot NO.:Q83I41 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTTRTLRFYALVGFLVFLDQVTKYLAHAYLARDFIVIPNLFRLTLAKNSGAAFSFGTGFS WLFFLLGIIALIFIGWFLPRTTGSIVFLALLQGGIAGNVFDRLFKPPYFGNGEVVDFLNT PLFSGVVFNIADLFILAGVFGTFLFLKGSK Protein Names:Recommended name: Lipoprotein signal peptidase EC= 3.4.23.36 Alternative name(s): Prolipoprotein signal peptidase Signal peptidase II Short name= SPase II Gene Names:Name:lspA Ordered Locus Names:TW250 Expression Region:1-150 Sequence Info:fµLl length protein

1,493.00 € 1493.0 EUR 1,493.00 €

1,493.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.