ELISA Recombinant Spiroplasma virus SpV1-C74 Uncharacterized protein ORF5(ORF5)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Spiroplasma virus SpV1-C74 (SpV1) Uniprot NO.:Q88416 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MVKMINLLVVENNNSNWDKIFSFVFDIFLFIFDVIWNTKLPMTNTSIAYFLVFFMVIKLS IYAIHGTSTQYNNLGSTVNNGVSQVYSSTVRKGINVGKNVYQNSNKQQVKKELKRQSIRY QAKNIRSTKFKGDKK Protein Names:Recommended name: Uncharacterized protein ORF5 Gene Names:ORF Names:ORF5 Expression Region:1-135 Sequence Info:fµLl length protein