ELISA Recombinant Pseudomonas syringae pv. tomato Protein CysZ homolog(cysZ)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Pseudomonas syringae pv. tomato (strain DC3000) Uniprot NO.:Q887V6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MPAPALTGPQYLREGLKLILSPGLRLFVLLPLSINIVLFCGLIYLAVHQFELWVDTFMPT LPHWLSFLSYILWPLFVALVLLMVFFTFTVVANIIAAPFNGFLSEKVEAVIRGVDESPDF SWAELVAMVPRTLAREARKLGYmLPRmLGLFILSFIPVANIIAAPLWLLFGVWMMAIQYI DYPADNHKLGWNEmLGWLKSKRWQSLSFGGIVYVALLIPVVNLLMMPAAVAAATLFWVRE RGADALPIAHARD Protein Names:Recommended name: Protein CysZ homolog Gene Names:Name:cysZ Ordered Locus Names:PSPTO_1177 Expression Region:1-253 Sequence Info:fµLl length protein