Skip to Content

ELISA Recombinant Pongo pygmaeus Tetraspanin-7(TSPAN7)

https://www.anagnostics.com/web/image/product.template/150238/image_1920?unique=41ec440
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Pongo pygmaeus (Bornean orangutan) Uniprot NO.:Q7YQK9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:METKPVITCLKTLLIIYSFVFWITGVILLAVGVWGKLTLGTYISLIAENSTNAPYVLIGT GTTIVVFGLFGCFATCRGSPWmLKLYAMFLSLVFLAELVAGISGFVFRHEIKDTFLRTYT DAMQTYDGKDDRSQAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQD LHNLTVAATKVNQKGCYDLVTSFMETNMGIIAGVAFGIAFSQLIGmLLACCLSRFITANQ YEMV Protein Names:Recommended name: Tetraspanin-7 Short name= Tspan-7 Alternative name(s): Transmembrane 4 superfamily member 2 CD_antigen= CD231 Gene Names:Name:TSPAN7 Synonyms:TM4SF2 Expression Region:1-244 Sequence Info:fµLl length protein

1,593.00 € 1593.0 EUR 1,593.00 €

1,593.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.