ELISA Recombinant Xylella fastidiosa Phosphate transport system permease protein pstA(pstA)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Xylella fastidiosa (strain TemecµLa1 / ATCC 700964) Uniprot NO.:Q87C89 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSTASQHLYKRRRLINAAAITISCIAALFGLFFLIWILWTLISKGLPGIDLDLFTKITPP PMQKGGLANAFLGSAIMCLLAIVIGTPVGIAAGTWLAEYGNTSQTSTVVRFVNDILLSAP SIVLGLFVYTLYVMHTGGHFSAFSGALALVFIVLPIVVRTTDEmLRLVPGQMREAALSLG IPQWKMITQVLYRSASAGILTGILLALARISGETAPLLFTAFGNQYWSSNIFQPIASLPL VMNQFASSPYKSWQLLAWSGALVLTVFVLLVSLGARALLLRNKIPNT Protein Names:Recommended name: Phosphate transport system permease protein pstA Gene Names:Name:pstA Ordered Locus Names:PD_1204 Expression Region:1-287 Sequence Info:fµLl length protein