ELISA Recombinant Xylella fastidiosa Lipase chaperone(lifO)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Xylella fastidiosa (strain TemecµLa1 / ATCC 700964) Uniprot NO.:Q87E55 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MIKKYSFVNHRIVLYLILGCVVVCGVWYSFDVRQAIDVGAVDLSLPQMSNNLLKEVAVGE GKTTNRLSRLPVDSTVPTVLPQSLAGSIAPPLPLDAYGHLARVSAVRDFFDYFLTAQNDL TPAALDEIVTHEIVKQLHGKSAQAEAQDVWTRYCAYFSQLVKLPDMGMVLGDKLDFVAVQ RALDQRASLAVRTLGDWSEPFFGAEQQRQRYDLERLKIADDQALTDEQKKKRLVALEQKL PSKVQEERIKIQQQQDAVVKIIQLQKDEVTPDGIRLQVVGLLGPEVAYRVAEIRRQDEIW QEKYKHYAAQRAQRAQIEAQQLEPKEHDVQVENLRQRIFTKPGEALRAASLDQ Protein Names:Recommended name: Lipase chaperone Alternative name(s): Lipase activator protein Lipase foldase Lipase helper protein Lipase modµLator Gene Names:Name:lifO Synonyms:lipB Ordered Locus Names:PD_0466 Expression Region:1-353 Sequence Info:fµLl length protein