ELISA Recombinant Pseudomonas syringae pv. tomato Sulfoxide reductase heme-binding subunit YedZ(yedZ)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Pseudomonas syringae pv. tomato (strain DC3000) Uniprot NO.:Q888N1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MRYPFWRLAVFLAACVAPVWWLYQAWIFALGPDPGKVLVENFGLATLVmLLITLAMTPLQ RLTGWPGWIVVRRQLGLWCFAYVVLHMTMYALFILGLDWGQLGVELVKRPYIIVGALAFL GLLALAVTSNRYSQRRLGSRWKKLHRLVYVILGLGLLHMFWIVRADLKEWALYAGIGAIL LLLRVPMIARRIPRLGGAAKAGSIKVQNNG Protein Names:Recommended name: SµLfoxide reductase heme-binding subunit YedZ Alternative name(s): Flavocytochrome YedZ Gene Names:Name:yedZ Ordered Locus Names:PSPTO_0986 Expression Region:1-210 Sequence Info:fµLl length protein