Skip to Content

ELISA Recombinant Rice tungro spherical virus Genome polyprotein

https://www.anagnostics.com/web/image/product.template/153868/image_1920?unique=e16ca1f
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rice tungro spherical virus (strain A) (RTSV) (Rice tungro spherical waikavirus) Uniprot NO.:Q83034 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:AIETLKETGLLKHIPKGAIGAGEEKLPEHSKKQSLSLEGKGNLGIVGQLTAQLVPTSVTK TTICKSMIHGLIGEIKTEPSVLSAWDRRLPFPPGEWDPMKDAVKKYGSYILPFPTEEIQE VENFLIKKFRRKENSRRTRNVNSLEVGINGIDGSDFWSPIEMKTSPGYPYILKRPSGAQG KKYLFEELEPYPSGRPKYAMKDPELIENYERIKEEVTSGVKPSIMTMECLKDERRKLAKI YEKPATRTFTILSPEVNILFRQYFGDFAAMVMSTRREHFSQVGINPESMEWSDLINSLLR VNTKGFAGDYSKFDGIGSPAIYHSIVNVVNAWYNDGEVNARARHSLISSIVHRDGICGDL ILRYSQGMPSGFAMTVIFNSFVNYYFMALAWMSTVGSSLLSPQGSCKDFDTYCKIVAYGD DNVVSVHEEFLDVYNLQTVAAYLSHFGVTYTDGDKNPIHMSKPYEDITKMSFLKRGFERV ESSGFLWKAPLDKTSIEERLNWIRDCPTPVEALEQNIESALHEAAIHGRDYFDDLVRRLN SALTRVmLPPTDISFEECQARWWASVTGALRAADYTSLVRRASSGHVEFNKKYRDMFRQQ DLPLKEILMKSKPVALLDLEV Protein Names:Recommended name: Genome polyprotein Cleaved into the following 7 chains: 1. Putative leader protein 2. Capsid protein 1 Short name= 3. CP-1 Alternative name(s): 22.5 kDa protein Coat protein 1 Capsid protein 2 Short nam Gene Names: Expression Region:2853-3473 Sequence Info:fµLl length protein

1,990.00 € 1990.0 EUR 1,990.00 €

1,990.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.