ELISA Recombinant Suid herpesvirus 1 Glycoprotein K(gK)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Suid herpesvirus 1 (strain Kaplan) (SuHV-1) (Pseudorabies virus (strain Kaplan))
Uniprot NO.:Q85230
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:GLGAYYATVARLPHPVVYAALPLGEDAAGGAPDWEAFNATAIYVAPNETDALSPALRDRA RVVYARRDCRAYLWDVHFRLAAVAWLLYAAFVYARQERRMFGPFRDPAEFLTPEKYTLNY AASVLAATVIGCSYTKFAWYMAELATRRAALSRDLREDPITLAHRHPTLIALILLELGLR LGARMALFTTLGVTRAPCALVFPLYARALVWIFVLAVGALELLAATLPHIARVSGATATP ARSDGGRAALGVCGACCSTVLAGIFAKALYLCLLVGGVLLFLHYERHITIFG
Protein Names:Recommended name: Glycoprotein K Short name= gK Alternative name(s): Syncytial protein
Gene Names:Name:gK ORF Names:µL53
Expression Region:21-312
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.