ELISA Recombinant Vaccinia virus Virion membrane protein A9(VACWR128)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR)) Uniprot NO.:Q85320 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:AIDLCRHFFMYFCEQKLRPNSFWFVVVRAIASMIMYLVLGIALLYISEQDDKKNTNNANT NNDSNSNNSNNDKRNESSINSNSSPK Protein Names:Recommended name: Virion membrane protein A9 Gene Names:Ordered Locus Names:VACWR128 ORF Names:A9L Expression Region:23-108 Sequence Info:fµLl length protein