ELISA Recombinant Xylella fastidiosa Phosphate transport system permease protein pstC(pstC)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Xylella fastidiosa (strain TemecµLa1 / ATCC 700964) Uniprot NO.:Q87C90 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTSTLIPKETSTPGGRDLRDARADYFFKLLLTAAVAFVLIALVSAALSmLWGGRQALQLQ GVSFFYSTEWNPVENKYGALTPIYGTIVTALIAmLIAMPVSLGIAFFLTEVAPRWLRTPI GTAIELLAGIPSIIYGMWGLFVLVPVMTDYITPFLNDHIGTLPLIGTLFQGPPLGIGTLT AGFVLAIMVIPFISSMMREVFLTVPTQLKESAYALGSTKWEVSWNIVLPYTRSAVIGGMF LGLGRALGETMAVAFVIGNSVRLSPSLLTPGTTIAALIANDFGEATETYRSALLLLGFVL FIVTFAVLVIARLmLLRLSRKEGN Protein Names:Recommended name: Phosphate transport system permease protein pstC Gene Names:Name:pstC Ordered Locus Names:PD_1203 Expression Region:1-324 Sequence Info:fµLl length protein