ELISA Recombinant Xylella fastidiosa UPF0394 membrane protein PD_1893(PD_1893)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Xylella fastidiosa (strain TemecµLa1 / ATCC 700964) Uniprot NO.:Q87AD3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNLHFYSTLRFTVALAAGLLFGFGLALSEMINPIRVLSFLNVASGHWNPSLLFVLGSALA VAFPGMALQRRLKRPLLDECFHLPSKKVIDRRIVFGSAIFGTGWGLTGLCPGPAIASLST GLGSVLLFVAAMAAGMIIHDRIVVRSLS Protein Names:Recommended name: UPF0394 membrane protein PD_1893 Gene Names:Ordered Locus Names:PD_1893 Expression Region:1-148 Sequence Info:fµLl length protein