ELISA Recombinant Triticum aestivum Cytochrome b6-f complex iron-sulfur subunit, chloroplastic(petC)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Triticum aestivum (Wheat) Uniprot NO.:Q7X9A6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:ADRVPDMSKRELMNLLLLGAISLPTFGmLVPYGSFLVPAGSGSNAGGVAAKDKLGNDILV EDWLKTHGPNDRTLAQGLKGDPTYLVVESDKTLATYGINAVCTHLGCVVPWNAAENKFLC PCHGSQYNNQGKVVRGPAPLSLALVHADVDDGKVVFVPWVETDFRTGDNPWWK Protein Names:Recommended name: Cytochrome b6-f complex iron-sµLfur subunit, chloroplastic EC= 1.10.9.1 Alternative name(s): Plastohydroquinone:plastocyanin oxidoreductase iron-sµLfur protein Rieske iron-sµLfur protein Short name= ISP Shor Gene Names:Name:petC Expression Region:50-222 Sequence Info:fµLl length protein