ELISA Recombinant Podospora anserina Rhomboid protein 2(RBD2)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Podospora anserina (Pleurage anserina) Uniprot NO.:Q874X5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MPPNITALNTTRARTYVFRLPLFTRVVIIAIVGFWLAGLQSIVDIQQWGALIPDEMGLAT LYRMNTFPFIHLNIFHAVMNILALTPLMERFEAEYGTLNCLALFFGPLTTIPAFLYIGLE KFVFGNNVAVMGASMWVFLLLGVEAVKTYKVNPNFVIGTYSIPTWTTPIGVLFAMAVLVP SSSFWGHAAGLVIGYGGMFSSTLNKKEKRQCADVKGVAGLGYVKFLAPPEKILRWIEGKL NLLGRLPHYVSIDQKTYGRFGVLPSNNTPAAASPGVALGLVGSTQRLGP Protein Names:Recommended name: Rhomboid protein 2 EC= 3.4.21.- Gene Names:Name:RBD2 ORF Names:Pa5D0065 Expression Region:1-289 Sequence Info:fµLl length protein