ELISA Recombinant Tamiami virus Pre-glycoprotein polyprotein GP complex(GPC)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Tamiami virus (isolate Rat/United States/W 10777/1964) (TAMV) Uniprot NO.:Q8AYY5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:SFFTWSLSDAVGNDMPGGYCLEKWmLIASQLKCFGNTAVAKCNLNHDSEFCDmLRLFDFN RKAIETLQNKTRSQLNIAINAINSLISDNLLMKNRVKELMDIPFCNYTKFWYVNHTKLNH HSLPRCWLVKNGSYLNESEFRNDWLLESDHLISEILSREYEERQGRTPLSLVDVCFWSTL FYTASIFLHLIRIPTHRHIVGEGCPKPHRLRADSTCACGLYKQKRRPLKWVRSN Protein Names:Recommended name: Pre-glycoprotein polyprotein GP complex Cleaved into the following 3 chains: 1. Stable signal peptide Short name= 2. SSP 3. Glycoprotein G1 Short name= 4. GP1 5. Glycoprotein G2 Short name= 6. GP2 Gene Names:Name:GPC Synonyms:GP-C Expression Region:252-485 Sequence Info:fµLl length protein