ELISA Recombinant Tupaia minor B1 bradykinin receptor(BDKRB1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Tupaia minor (Lesser tree shrew) Uniprot NO.:Q8HZP1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAAQTLLELQPSNQSQLSALNTTSCDNAREAWDLLYQVLPIFILTICAFGLLGNLFVLSV FLLLRRRLTVAEIYLVNLAASDLVFVLGLPFWAQNIWNQFNWPFGDLLCRVVNGVIKANL FISIFLMVAISQDRYCVLVHPMASRRRRRRRRARATCMVIWAVGALLSTPTFLLRSVSAV QDLNISACILLLPHQAWHVARIVELNVLGFLLPLAAIIFFNGHILASLRGQGEVSQTRIG GPKDCKTTVLILTLVAAFLVCWAPYHCFAFLEFLFQVRAVRGCFWEDFIDLGLQLANFFA FTNSCLNPVIYVFVGRLFRTKVWELYQQCTPRRPAPLSSSRRKEILRRFWRN Protein Names:Recommended name: B1 bradykinin receptor Short name= B1R Short name= BK-1 receptor Gene Names:Name:BDKRB1 Expression Region:1-352 Sequence Info:fµLl length protein