ELISA Recombinant Rat Lipid phosphate phosphohydrolase 2(Ppap2c)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q8K593 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MERRWVFVLLDVLCVLVASLPFIILTLVNAPYKRGFYCGDDSIRYPYRPDTITHGLMAGV IITATVVLVSSGEAYLVYTDRLYSRSDFNNYVAAIYKVLGTFLFGAAVSQSLTDLAKYMI GRLRPSFLAVCDPDWSRVNCSGYVQVEVCRGSPANVTEARLSFYSGHSSFGMYCmLFLAL YVQARLCWKWARLLRPTVQFFLVAFAIYVGYTRVSDNKHHWSDVLVGLLQGALVACLTVC YVSDFFKSRPPQSCQENEESERKPSLSLTLTLGDRP Protein Names:Recommended name: Lipid phosphate phosphohydrolase 2 EC= 3.1.3.4 Alternative name(s): PAP2-gamma Short name= PAP2-G Phosphatidate phosphohydrolase type 2c Phosphatidic acid phosphatase 2c Short name= PAP-2c Short n Gene Names:Name:Ppap2c Synonyms:Lpp2 Expression Region:1-276 Sequence Info:fµLl length protein