ELISA Recombinant Staphylococcus epidermidis Multidrug resistance efflux pump sepA(sepA)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Staphylococcus epidermidis (strain ATCC 12228) Uniprot NO.:Q8CRK7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKFLKNKSYHLLVTLIVLTIFVISGAIFLTFLGFGLYGLSRILIYLHLGDFSYNKGFYDN LIYYGSYIVLGYFTLFSIEHLMDYFKKNLPKNPYFQGINFHLISYIVTTIMFYFIVHIHY VHVNIHFWVIMIIIGFLFVCKEVFYPESKNLNNKK Protein Names:Recommended name: MµLtidrµg resistance efflux pump sepA Alternative name(s): Antiseptic resistance protein sepA Staphylococcal efflux pump A Gene Names:Name:sepA Ordered Locus Names:SE_1758 Expression Region:1-155 Sequence Info:fµLl length protein