ELISA Recombinant Thermosynechococcus elongatus NAD(P)H-quinone oxidoreductase subunit 3(ndhC)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Thermosynechococcus elongatus (strain BP-1) Uniprot NO.:Q8DJ02 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:VAIPRLRDTATVFVLSGYEYFLGFLIICSLVPVLALAASALLRPKSGRMIRLTTYESGME PIGGAWIQFNVRYYMFALVFVIFDVETVFLYPWAVAFHQLGLLAFIEALIFIAILVVALV YAWRKRALEWS Protein Names:Recommended name: NAD(P)H-quinone oxidoreductase subunit 3 EC= 1.6.5.- Alternative name(s): NAD(P)H dehydrogenase subunit 3 NADH-plastoquinone oxidoreductase subunit 3 NDH-1 subunit 3 Short name= NDH-C Gene Names:Name:ndhC Ordered Locus Names:tlr1429 Expression Region:2-132 Sequence Info:fµLl length protein