ELISA Recombinant Staphylococcus epidermidis Putative antiporter subunit mnhB2(mnhB2)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Staphylococcus epidermidis (strain ATCC 12228) Uniprot NO.:Q8CQ49 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKENDVVLKSVTKIVVFILLTFGFYVFFAGHNNPGGGFIGGLIFSSAFILMFLAFDVNEV LKSLPIDFKKLMIIGSLISVATASVPMFFGKPFLYQTEANVTFPLLGHVHVTTVTLFELG ILLTVVGVIVTVmLSISGGRS Protein Names:Recommended name: Putative antiporter subunit mnhB2 Alternative name(s): Mrp complex subunit B2 Putative NADH-ubiquinone oxidoreductase subunit mnhB2 Gene Names:Name:mnhB2 Synonyms:mrpB2 Ordered Locus Names:SE_0398 Expression Region:1-141 Sequence Info:fµLl length protein