ELISA Recombinant Streptococcus pneumoniae Membrane protein insertase YidC 2(yidC2)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Streptococcus pneumoniae (strain ATCC BAA-255 / R6) Uniprot NO.:Q8DN93 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:CATNGVTSDITAESADFWSKLVYFFAEIIRFLSFDISIGVGIILFTVLIRTVLLPVFQVQ MVASRKMQEAQPRIKALREQYPGRDMESRTKLEQEMRKVFKEMGVRQSDSLWPILIQMPV ILALFQALSRVDFLKTGHFLWINLGSVDTTLVLPILAAVFTFLSTWLSNKALSERNGATT AMMYGIPVLIFIFAVYAPGGVALYWTVSNAYQVLQTYFLNNPFKIIAEREAVVQAQKDLE NRKRKAKKKAQKTK Protein Names:Recommended name: Membrane protein insertase YidC 2 Alternative name(s): Foldase YidC 2 Membrane integrase YidC 2 Membrane protein YidC 2 Gene Names:Name:yidC2 Ordered Locus Names:spr1852 Expression Region:23-276 Sequence Info:fµLl length protein