ELISA Recombinant Shewanella oneidensis Aquaporin Z(aqpZ)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Shewanella oneidensis (strain MR-1) Uniprot NO.:Q8EHC1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSQKMAAEFLGTLWLVLGGCGSAVLAAAFPEVGIGLLGVSLAFGLTVLTMAFAIGHISGC HLNPAVSFGLWAGGRFPTSELLPYIIAQVAGGIAGAGVLYLIASGQEGFSLAAGFASNGF GEHSPGGYSMISVMICEIVMTLFFLLVILGSTDERAPKGFAPIAIGLCLTLIHLISIPIS NTSVNPARSTGPALFVGDWAVSQLWLFWAAPIIGAILAGVIYRYFNAAK Protein Names:Recommended name: Aquaporin Z Gene Names:Name:aqpZ Ordered Locus Names:SO_1307 Expression Region:1-229 Sequence Info:fµLl length protein