Skip to Content

ELISA Recombinant Xenopus laevis Blood vessel epicardial substance-A(bves-a)

https://www.anagnostics.com/web/image/product.template/161131/image_1920?unique=871b00d
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Xenopus laevis (African clawed frog) Uniprot NO.:Q8JH92 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTTESIFITTLPMDFNSQFDNITIGLNDNETLCENWREIHHLVFHLANTCFAAGLVIPST LNLHmLFLRGmLCLGCTFFIIWAVLFRCALDIMIWNATFLSINFMHFVYLVYKKRPIKIK KELKGIYHRMFEPLHVSPELFNRLTGQFCEIKTLAKGQTYAVEDKTSVDDRLSILLKGIM KVSYRGHFLHTISANAYIDSPEFRSTEMNRGETFQVTITADDNCVFLCWSRERLTYFLES EPFLYEIFKYLIGKDITTKLYSLNDPTLGKKRKLDTQPSLCSQLSVMEMRNSLASTNDNE DGLQNFLRGTSTTSSQRNKQQEFYNAYGVGPLSHAVFC Protein Names:Recommended name: Blood vessel epicardial substance-A Short name= Xbves-A Alternative name(s): Popeye domain-containing protein 1-A Short name= Popeye protein 1-A Short name= Xpop-1-A Gene Names:Name:bves-a Synonyms:pop1-a, popdc1-a Expression Region:1-338 Sequence Info:fµLl length protein

1,692.00 € 1692.0 EUR 1,692.00 €

1,692.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.