ELISA Recombinant Streptococcus pneumoniae UPF0397 protein spr0429(spr0429)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Streptococcus pneumoniae (strain ATCC BAA-255 / R6) Uniprot NO.:Q8DQY6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MEIKFTIKQVVAVGIGAALFVVIGMINIPTPVPNTSIQLQYAVQALLSIIFGPIIGLLVG LIGHAIKDSLVGYGLWWTWIIASGLFGLVVGLFRKYVRVINGVFDWKDILIFNLIQLLAN ALVWGVLAPLGDVVIYQEAAEKVFAQGIVAGIANGVSVAIAGTLLLLAYAGTQTRAGSLK KD Protein Names:Recommended name: UPF0397 protein spr0429 Gene Names:Ordered Locus Names:spr0429 Expression Region:1-182 Sequence Info:fµLl length protein