Skip to Content

ELISA Recombinant Streptococcus pneumoniae PTS system mannitol-specific EIICB component(mtlA)

https://www.anagnostics.com/web/image/product.template/159008/image_1920?unique=b3f4f0f
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Streptococcus pneumoniae (strain ATCC BAA-255 / R6) Uniprot NO.:Q8DR34 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MEEKVSLKVRVQKLGTSLSNMVMPNIGAFIAWGVLTALFIADGYLPNEQLATVVGPmLTY LLPILIGYTGGYMIHGQRGAVVGSIATVGAITGSSVPMFIGAMVMGPLGGWTIKKFDEKF QEKIRPGFEmLVNNFSAGLVGFALLLLAFYAIGPVVSTLTGAVGNGVEAIVNARLLPMAN IIIEPAKVLFLNNALNHGIFTPLGVEQVAQAGKSILFLLEANPGPGLGILLAYAVFGKGS AKSSSWGAMVIHFFGGIHEIYFPYVMMKPTLFLAAMAGGISGTFTFQLLDAGLKSPASPG SIIAIMATAPKGVWPHLNILLGVLVAAVVSFLIAALILHADKSTEDSLEAAQAATQAAKA QSKGQLVSTSVDAVVSTDSVEKIIFACDAGMGSSAMGASILRDKVKKAGLELPVSNQAIS NLLDTPKTLIVTQEELTPRAKDKSPSAIHVSVDNFLASPRYDEIVASLTGASPIAEIEGD IPTSAPVDSQEIDLNHIDAVVVAYGKAQGTATMGCETIRAIFRNKNIRIPVSTAKISELG EFNSKNIMIVTTISLQAEVQQAAPNSQFLIVDSLVTTPEYDKMAARMYK Protein Names:Recommended name: PTS system mannitol-specific EIICB component Alternative name(s): EIICB-Mtl Short name= EII-Mtl Including the following 2 domains: Mannitol permease IIC component Alternative name(s): PTS system mannitol-specif Gene Names:Name:mtlA Ordered Locus Names:spr0356 Expression Region:1-589 Sequence Info:fµLl length protein

1,957.00 € 1957.0 EUR 1,957.00 €

1,957.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.