ELISA Recombinant Rabbit Anion exchange transporter(SLC26A7)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Oryctolagus cunicµLus (Rabbit) Uniprot NO.:Q8HY59 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:LFSFKELNEQFKRKIKVVLPVDLVLIIAASFACYCTNMENTYGLEVVGHIPRGIPPPRAP PMNILSAVITEAFGVALVGYAASLALAQGSAKKFKYSVDDNQEFLAHGLSNVISSFLFCI PSAAAMGR Protein Names:Recommended name: Anion exchange transporter Alternative name(s): Solute carrier family 26 member 7 Gene Names:Name:SLC26A7 Expression Region:1-128 Sequence Info:fµLl length protein