ELISA Recombinant Staphylococcus epidermidis Protoheme IX farnesyltransferase(ctaB)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Staphylococcus epidermidis (strain ATCC 12228) Uniprot NO.:Q8CPM1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNKDQTLSHTTGRVSFKELQQIIKMGLVQGNLIPAFAGAWLAIVMTNHSFLSSIPQILLM LVGSTLIMGGACALNNYYDQDIDRIMPSKQGRPTVNDRISDRNLLmLSFGMmLIGEACLF LLNIPSGVLGLIGIVGYVSYYSIWSKRHTTWNTVVGSFPGAVPPLIGWVAIDGSLSLAAV ALFLVVFCWQPIHFYALAIKRSDEYALANIPmLPSVKGFKRTRVSMFIWLVLLLPLPFLL SNLGVTFVVIATLLNLGWLALGFTTFRKESNQTKWATQMFVYSLNYLVVFFALVVVVSLI KMI Protein Names:Recommended name: Protoheme IX farnesyltransferase EC= 2.5.1.- Alternative name(s): Heme B farnesyltransferase Heme O synthase Gene Names:Name:ctaB Ordered Locus Names:SE_0815 Expression Region:1-303 Sequence Info:fµLl length protein