ELISA Recombinant Streptococcus pneumoniae 1-acyl-sn-glycerol-3-phosphate acyltransferase(plsC)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Uniprot NO.:Q8DNY1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MIRYNNNKKTIEGDRMFYTYLRGLVVLLLWSINGNAHYHNTDKIPNQDENYILVAPHRTW WDPVYMAFATKPKQFIFMAKKELFTNRIFGWWIRMCGAFPIDRENPSASAIKYPINVLKK SDRSLIMFPSGSRHSNDVKGGAALIAKMAKVRIMPVTYTGPMTLKGLISRERVDMNFGNP IDISDIKKMNDEGIETVANRIQTEFQRLDEETKQWHNDKKPNPLWWFIRIPALILAIILA ILTIIFSFIASFIWNPDKKREELA
Protein Names:Recommended name: 1-acyl-sn-glycerol-3-phosphate acyltransferase Short name= 1-AGP acyltransferase Short name= 1-AGPAT Short name= 1-acyl-G3P acyltransferase EC= 2.3.1.n4 Alternative name(s): Lysophosphatidic acid acylt
Gene Names:Name:plsC Ordered Locus Names:spr1465
Expression Region:1-264
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.