ELISA Recombinant Streptococcus pneumoniae 1-acyl-sn-glycerol-3-phosphate acyltransferase(plsC)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Streptococcus pneumoniae (strain ATCC BAA-255 / R6) Uniprot NO.:Q8DNY1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MIRYNNNKKTIEGDRMFYTYLRGLVVLLLWSINGNAHYHNTDKIPNQDENYILVAPHRTW WDPVYMAFATKPKQFIFMAKKELFTNRIFGWWIRMCGAFPIDRENPSASAIKYPINVLKK SDRSLIMFPSGSRHSNDVKGGAALIAKMAKVRIMPVTYTGPMTLKGLISRERVDMNFGNP IDISDIKKMNDEGIETVANRIQTEFQRLDEETKQWHNDKKPNPLWWFIRIPALILAIILA ILTIIFSFIASFIWNPDKKREELA Protein Names:Recommended name: 1-acyl-sn-glycerol-3-phosphate acyltransferase Short name= 1-AGP acyltransferase Short name= 1-AGPAT Short name= 1-acyl-G3P acyltransferase EC= 2.3.1.n4 Alternative name(s): Lysophosphatidic acid acylt Gene Names:Name:plsC Ordered Locus Names:spr1465 Expression Region:1-264 Sequence Info:fµLl length protein