ELISA Recombinant Pyrococcus furiosus Protein translocase subunit SecF(secF)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) Uniprot NO.:Q8U4B5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MPEVDNVIKEKLKLLVEMDPKKMIIYPLIVFGIAIIIIIANYVMTGSFVKEGIELRGGSV ITLQGVNVSPDEIAKSIKEKTGIDVTVEKFSGVGGSGVRVYVSAGDDVNLVREALKEMFP DVEPQTVVIGPTFGEIVREQGIKAIVYAFIGMAIVVFLFFRVPVPSMTVVFSAFSDMIIA IALMNIFGIELSQATIAALLmLIGYSVDSNILLTTRLLRRKEFTVEEAYYSSLKTGFTMS TTTLGALASLWIFSTAQVIDDIASVLIFGLLADFMNTWILNAGVLRLYIAKREGKE Protein Names:Recommended name: Protein translocase subunit SecF Gene Names:Name:secF Ordered Locus Names:PF0173 Expression Region:1-296 Sequence Info:fµLl length protein