ELISA Recombinant Pyrobaculum aerophilum Cobalamin synthase(cobS)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:PyrobacµLum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) Uniprot NO.:Q8ZZ89 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MRCLKSLLAFFTAFPIGGAELSFKCVWALPYVAAPIIAAIPTTLLYLGASPAIAYIALLA ATGLHHLDGLADVGDALLVRDREAARRVLEDPRRGTGGIFAVTAVVVTTAAHLHSPLQLL LGEVFSKSTALLFAGFSKSFKPGLGEAFTEAAKRQWPAALPALAVLAYLAPVTTAVSLAT SALLYQLAYRHLGGANGDVYGYLLEVSRSAFVIWSAYVPVPTAF Protein Names:Recommended name: Cobalamin synthase EC= 2.-.-.- Gene Names:Name:cobS Ordered Locus Names:PAE0379 Expression Region:1-224 Sequence Info:fµLl length protein