ELISA Recombinant Xenopus laevis Glutamate receptor, ionotropic kainate 2(grik2)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Xenopus laevis (African clawed frog) Uniprot NO.:Q91755 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:SELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYG AVQDGATMTFFKKSRIPTYEKMWAFMNSRSQSVLVKNNEEGIQRALTSDYAFLMESTTIE FVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGVLHMMKEKWWRGNG CPEEESKEASALGVQNIGGIFIVLAAGLVLSVFVAVGEFLYKSKKNAQLEKRSFCSAMVE ELRMSLKCQRRLKHKPQPPVIVKTEEVINMHTFNDRRLPGKETMA Protein Names:Recommended name: Glutamate receptor, ionotropic kainate 2 Alternative name(s): Glutamate receptor 6 Short name= GluR-6 Short name= GluR6 Gene Names:Name:grik2 Synonyms:glur6 Expression Region:1-285 Sequence Info:fµLl length protein